PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun005872
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 169aa    MW: 19347.8 Da    PI: 8.4629
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-29033PU_refplantGDBView CDS
gnl|UG|Vun#S45791271PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1875128356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Vun005872  75 KKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 128
                456899***********************************************9 PP

2HD-ZIP_I/II130.37.5e-4274162189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+y+a+k++n++L++++++L++
    Vun005872  74 EKKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQYEAIKADNDALQAQNQKLQT 162
                  69*************************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-2067132IPR009057Homeodomain-like
PROSITE profilePS5007117.39470130IPR001356Homeobox domain
SMARTSM003891.8E-1873134IPR001356Homeobox domain
PfamPF000466.2E-1675128IPR001356Homeobox domain
CDDcd000861.24E-1575131No hitNo description
Gene3DG3DSA:1.10.10.608.1E-2077137IPR009057Homeodomain-like
PRINTSPR000315.1E-6101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000315.1E-6110126IPR000047Helix-turn-helix motif
PfamPF021839.1E-14130168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MAFFPANFML QTPHQDDHQP PPSLNSIITS CAPQEYHGGA SFLGKRSMSF SGIELGEEAN  60
AEEDLSDDGS QAGEKKRRLN MEQVKTLEKS FELGNKLEPE RKMQLARALG LQPRQIAIWF  120
QNRRARWKTK QLEKDYDLLK RQYEAIKADN DALQAQNQKL QTERLALKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122130RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153821.11e-120hypothetical protein PHAVU_003G067700g
SwissprotQ8LC033e-82ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0L9TLK71e-120A0A0L9TLK7_PHAAN; Uncharacterized protein (Fragment)
STRINGGLYMA18G15970.11e-119(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-79HD-ZIP family protein